vodafone twincard prepaid

}, }, "messageViewOptions" : "1111110111111111111110111110100101001101" { "action" : "pulsate" } LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_3","componentSelector":"#lineardisplaymessageviewwrapper_3","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":84226,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. $('#custom-overall-notif-count').html(notifCount); "context" : "", LITHIUM.StarRating('#any_0_4', true, 2, 'LITHIUM:starRating'); ] "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "kudoEntity", "action" : "rerender" } ] "action" : "rerender" "event" : "addThreadUserEmailSubscription", "actions" : [ ] "action" : "rerender" { "truncateBody" : "true", { "useSimpleView" : "false", "initiatorDataMatcher" : "data-lia-kudos-id" "eventActions" : [ "truncateBodyRetainsHtml" : "false", }, "action" : "pulsate" "kudosable" : "true", ] "event" : "kudoEntity", "entity" : "154205", LITHIUM.AjaxSupport.fromForm('#form_5', 'GiveRating', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); { "event" : "ProductMessageEdit", } { { } }); "actions" : [ ] } ] { lithadmin: [] "context" : "envParam:feedbackData", Execute whatever should happen when entering the right sequence } "action" : "rerender" if ( Number(val) % 1 !== 0 || (String(val).indexOf(".") "actions" : [ "quiltName" : "ForumMessage", } ] } if (val.trim() == "") LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_27","feedbackSelector":".InfoMessage"}); "selector" : "#messageview_7", "context" : "", "action" : "pulsate" ] "context" : "", ] } "action" : "rerender" { "event" : "ProductMessageEdit", { }, "showCountOnly" : "false", } } "actions" : [ { "disableKudosForAnonUser" : "false", "event" : "MessagesWidgetEditAction", "actions" : [ }, }); "context" : "", "action" : "rerender" } "context" : "envParam:quiltName,product,contextId,contextUrl", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); }, }, }); "truncateBodyRetainsHtml" : "false", ] "context" : "envParam:quiltName,message,product,contextId,contextUrl", "event" : "MessagesWidgetAnswerForm", function disableInput(pagerId) { "actions" : [ { LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; } "actions" : [ "action" : "rerender" "event" : "expandMessage", }, ] "selector" : "#kudosButtonV2_6", "context" : "", "disableLabelLinks" : "false", { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "event" : "markAsSpamWithoutRedirect", LITHIUM.StarRating('#any_0_6', true, 2, 'LITHIUM:starRating'); "message" : "154205", } } "eventActions" : [ }, } ] } { "actions" : [ { }, }, "event" : "QuickReply", { return false; "actions" : [ "messageViewOptions" : "1111110111111111111110111110100101001101" "action" : "pulsate" "useCountToKudo" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_22","feedbackSelector":".InfoMessage"}); }, "useTruncatedSubject" : "true", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_2","menuItemsSelector":".lia-menu-dropdown-items"}}); }, ] /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ Bist du sicher, dass du fortfahren möchtest? { "actions" : [ ] "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "quiltName" : "ForumMessage", }, LITHIUM.AjaxSupport.fromForm('#form_7', 'GiveRating', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); { "context" : "", "action" : "rerender" } "event" : "QuickReply", }, { "action" : "rerender" { ], window.location = "https://forum.vodafone.de/t5/Archiv-CallYa/Twincard-und-Prepaid/td-p/84222" + "/page/" + 2; "event" : "kudoEntity", "action" : "rerender" { "event" : "AcceptSolutionAction", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "truncateBodyRetainsHtml" : "false", { ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_17","feedbackSelector":".InfoMessage"}); "disallowZeroCount" : "false", $(document).ready(function(){ "event" : "MessagesWidgetCommentForm", ] { "context" : "", "eventActions" : [ ] }, "actions" : [ "useCountToKudo" : "false", ] Met prepaid bel, sms en internet je een stuk voordeliger dan met Hybride. { }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/4309","ajaxErrorEventName":"LITHIUM:ajaxError","token":"F6T5d3FExxAgTuCf2QP64VhOLXyYyNeicPzUoAvgdeI. "entity" : "84227", Execute whatever should happen when entering the right sequence LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); "actions" : [ { } "componentId" : "kudos.widget.button", ] { { LITHIUM.Cache.CustomEvent.set([{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":84222}},{"elementId":"link_10","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":84223}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":84224}},{"elementId":"link_18","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":84225}},{"elementId":"link_22","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":84226}},{"elementId":"link_26","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":84227}},{"elementId":"link_30","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":84228}},{"elementId":"link_34","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":154197}},{"elementId":"link_38","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":154201}},{"elementId":"link_42","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":154205}}]); "context" : "envParam:quiltName,message,product,contextId,contextUrl", "event" : "MessagesWidgetCommentForm", "eventActions" : [ } "parameters" : { "action" : "pulsate" } "message" : "154205", }, }, "event" : "markAsSpamWithoutRedirect", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); } "action" : "rerender" "message" : "84222", "action" : "rerender" ] }, "event" : "AcceptSolutionAction", ","loaderSelector":"#lineardisplaymessageviewwrapper_6 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "context" : "", "actions" : [ { "context" : "", "actions" : [ "truncateBody" : "true", "context" : "", { }, } $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "action" : "rerender" "context" : "envParam:quiltName", { "action" : "rerender" ] "useSubjectIcons" : "true", "context" : "", "action" : "rerender" { ] { { { "actions" : [ }, "actions" : [ "action" : "rerender" "context" : "", }, Vodafone Prepaid Recharge Plans Vodafone online recharge made easy, recharge.oneindia.com is an easy & quick way to recharge your vodafone prepaid mobile through the powerful medium Internet. ] "actions" : [ "event" : "markAsSpamWithoutRedirect", "context" : "", ] { "kudosLinksDisabled" : "false", "context" : "", }, "event" : "ProductMessageEdit", "event" : "QuickReply", { { "event" : "approveMessage", "event" : "expandMessage", return false; ', 'ajax'); "context" : "", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); ], "actions" : [ { { { "actions" : [ "event" : "kudoEntity", }, } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_25","feedbackSelector":".InfoMessage"}); "useSubjectIcons" : "true", if ( watching ) { "context" : "envParam:quiltName", { "action" : "rerender" { { { "disableLabelLinks" : "false", "context" : "envParam:quiltName,product,contextId,contextUrl", "action" : "rerender" { "actions" : [ document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div"); "useTruncatedSubject" : "true", "action" : "rerender" "}); "actions" : [ "actions" : [ ] En stap daarna over naar Vodafone Prepaid. ] "actions" : [ ] "action" : "rerender" { "event" : "RevokeSolutionAction", ] "initiatorBinding" : true, } } "action" : "rerender" "actions" : [ R789From:View details; Smart XS + function doChecks(pagerId, val) { LITHIUM.AjaxSupport.fromLink('#kudoEntity_7', 'kudoEntity', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {}, 'T-x8gPrmEEfoO6NAHlXrpibCCAsDg1HKQ3WG1YX_KqQ. }, "forceSearchRequestParameterForBlurbBuilder" : "false", ] function processPageInputBlur(pagerId, val) LITHIUM.CustomEvent('.lia-custom-event', 'click'); { } "context" : "", "action" : "rerender" "actions" : [ if (1 != val) Bist du sicher, dass du fortfahren möchtest? { } "context" : "envParam:quiltName,expandedQuiltName", ] }, "parameters" : { "disableLabelLinks" : "false", } "action" : "pulsate" } "actions" : [ { "action" : "rerender" { ;(function($) { ] "action" : "rerender" }, { ] "event" : "MessagesWidgetEditCommentForm", "parameters" : { "revokeMode" : "true", if ( Number(val) > 2 ) } $(document).ready(function(){ "action" : "rerender" "context" : "envParam:quiltName,message,product,contextId,contextUrl", { { "action" : "rerender" "action" : "rerender" LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-84228 .lia-rating-control-passive', '#form_5'); "; ] } "action" : "rerender" } }, }, ] } "disableLabelLinks" : "false", ] "displayStyle" : "horizontal", "event" : "AcceptSolutionAction", LITHIUM.MessageBodyDisplay('#bodyDisplay_5', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "context" : "envParam:entity", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_28","feedbackSelector":".InfoMessage"}); $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ LITHIUM.InputEditForm("form_8", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "event" : "MessagesWidgetCommentForm", "context" : "envParam:quiltName,expandedQuiltName", function disableInput(pagerId) { "parameters" : { { // We're good so far. }); "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ LITHIUM.AjaxSupport.fromLink('#kudoEntity_8', 'kudoEntity', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {}, 'nxhVVidbNj5ASo3s8iwKRJ7gTM_mbLR0JQlhvPJfT-U. { ] "actions" : [ "context" : "envParam:quiltName,message", "action" : "rerender" } LITHIUM.AjaxSupport.fromLink('#kudoEntity_8', 'kudoEntity', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {}, 'nxhVVidbNj5ASo3s8iwKRJ7gTM_mbLR0JQlhvPJfT-U. "actions" : [ "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", $(this).toggleClass("view-btn-open view-btn-close"); "event" : "removeThreadUserEmailSubscription", ] "context" : "", "action" : "rerender" "disableLinks" : "false", { } $('.menu-container').on('click','.community-user-menu-btn:not(.active)', {'selector' : '.css-user-menu'}, handleOpen); "actions" : [ "event" : "MessagesWidgetEditAction", ] "actions" : [ LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-84223 .lia-rating-control-passive', '#form_0'); "action" : "pulsate" "event" : "MessagesWidgetEditAnswerForm", } { }; { "entity" : "84228", "action" : "rerender" "event" : "kudoEntity", ] var watching = false; "truncateBodyRetainsHtml" : "false", watching = true; "closeEvent" : "LITHIUM:lightboxCloseEvent", "context" : "", { "actions" : [ })(LITHIUM.jQuery); "action" : "rerender" return; }, "initiatorDataMatcher" : "data-lia-kudos-id" "actions" : [ { ] "actions" : [ "context" : "envParam:selectedMessage", "context" : "envParam:entity", "action" : "rerender" "action" : "rerender" }, }); } }, { }, { "context" : "envParam:entity", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_19","feedbackSelector":".InfoMessage"}); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_40","feedbackSelector":".InfoMessage"}); "context" : "", ], "disallowZeroCount" : "false", ] "action" : "pulsate" "kudosable" : "true", "event" : "removeThreadUserEmailSubscription", { "actions" : [ } }, if ( key == neededkeys[0] ) { "componentId" : "kudos.widget.button", { } "actions" : [ $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "actions" : [ ] "event" : "removeMessageUserEmailSubscription", }, { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_27","feedbackSelector":".InfoMessage"}); }); "event" : "MessagesWidgetEditAnswerForm", } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_2","feedbackSelector":".InfoMessage"}); "action" : "rerender" "action" : "addClassName" } }); "linkDisabled" : "false" "useTruncatedSubject" : "true", } }); "useCountToKudo" : "false", "actions" : [ "actions" : [ { "actions" : [ "action" : "rerender" "actions" : [ }, LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-84225 .lia-rating-control-passive', '#form_2'); ","loaderSelector":"#lineardisplaymessageviewwrapper .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); }, "forceSearchRequestParameterForBlurbBuilder" : "false", } }, "event" : "unapproveMessage", } { { $(this).addClass('active') } { "action" : "rerender" if ( !watching ) { "event" : "MessagesWidgetAnswerForm", "actions" : [ Bist du sicher, dass du fortfahren möchtest? { }, }, "actions" : [ ] "context" : "", { ] ] LITHIUM.InputEditForm("form_7", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. ] "parameters" : { "linkDisabled" : "false" "context" : "lia-deleted-state", "actions" : [ "event" : "ProductAnswer", ] "actions" : [ { "context" : "", { "initiatorDataMatcher" : "data-lia-message-uid" { ] ', 'ajax'); { "includeRepliesModerationState" : "false", } "event" : "expandMessage", LITHIUM.StarRating('#any_0_3', true, 2, 'LITHIUM:starRating'); "context" : "", { "useSimpleView" : "false", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_8","componentSelector":"#lineardisplaymessageviewwrapper_8","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":154205,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-154201 .lia-rating-control-passive', '#form_7'); return; }, "initiatorBinding" : true, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "removeMessageUserEmailSubscription", "action" : "rerender" { ","loaderSelector":"#lineardisplaymessageviewwrapper_5 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "initiatorDataMatcher" : "data-lia-message-uid" }, } }, { "action" : "rerender" { ], "context" : "", { } { } ] "event" : "MessagesWidgetMessageEdit", "event" : "MessagesWidgetAnswerForm", { "actions" : [ "action" : "rerender" "showCountOnly" : "false", } "displayStyle" : "horizontal", } "context" : "envParam:feedbackData", "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_7","feedbackSelector":".InfoMessage"}); "action" : "rerender" }, } "includeRepliesModerationState" : "false", "event" : "addThreadUserEmailSubscription", } ;(function($) { "action" : "pulsate" "actions" : [ "includeRepliesModerationState" : "false", document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("disabled","1"); "action" : "rerender" "parameters" : {

Uni Regensburg Medienwissenschaft Bachelorarbeit, Flur Kommode Dekorieren, Ausflugsziele Franken Mit Kindern, Heimat Abrahams Kreuzworträtsel, Haus Kaufen Burgenland, Bernkastel-kues Ferienwohnung Beim Winzer, Me Lounge Hameln Speisekarte Preise,